PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_47908
Common NameKK1_044258
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 198aa    MW: 23068.8 Da    PI: 7.0437
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_47908genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
    C.cajan_47908 16 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 63
                     79********************************************97 PP

2Myb_DNA-binding55.71.1e-1769112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
    C.cajan_47908  69 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 112
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-24966IPR009057Homeodomain-like
PROSITE profilePS5129417.2741163IPR017930Myb domain
SuperFamilySSF466899.73E-3113110IPR009057Homeodomain-like
SMARTSM007177.2E-131565IPR001005SANT/Myb domain
PfamPF002492.4E-161663IPR001005SANT/Myb domain
CDDcd001675.33E-101863No hitNo description
PROSITE profilePS5129425.85964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2567118IPR009057Homeodomain-like
SMARTSM007171.8E-1568116IPR001005SANT/Myb domain
PfamPF002491.5E-1669112IPR001005SANT/Myb domain
CDDcd001673.85E-1273112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDKKQCNTSQ DPEVRKGPWT MEEDLILINY IANHGEGVWN SLAKAAGLKR TGKSCRLRWL  60
NYLRPDVRRG NITPEEQLLI MELHAKWGNR WSKIAKHLPG RTDNEIKNYW RTRIQKHIKQ  120
AENFQQQSNS ETNDHQASTS QVSTMAEPIE TYSPPCYQGM LEPFSTQFPT IPDQSNTNEN  180
NNYWSMEDIW SMQLLNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271111822128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0901840.0BT090184.1 Soybean clone JCVI-FLGm-3H24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140962.11e-133hypothetical protein PHAVU_008G155700g
SwissprotP813913e-97MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A151QWW31e-149A0A151QWW3_CAJCA; Myb-related protein 305 family
STRINGGLYMA19G14270.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.15e-89myb domain protein 21